PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678316227
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family FAR1
Protein Properties Length: 456aa    MW: 51859.5 Da    PI: 6.3892
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678316227genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR189.45.1e-28291378291
       FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                fYn+YA++vGF +r+sk ++s+r+g+ + r +vC+keg+r ++k++  k  r+raetr+gC+a++ v+k  +gkw vtk+++eH+H+l+p
  678316227 291 FYNSYATRVGFIIRVSKLSRSRRDGSAIGRALVCNKEGFRMPDKRE--KIVRQRAETRVGCRAMILVRKIGSGKWIVTKFVKEHTHPLTP 378
                9*****************************************9988..9**************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF514451.35E-371171IPR017853Glycoside hydrolase superfamily
Gene3DG3DSA:3.20.20.801.9E-411171IPR013781Glycoside hydrolase, catalytic domain
PfamPF002325.1E-97106IPR001360Glycoside hydrolase family 1
PRINTSPR001314.0E-102337IPR001360Glycoside hydrolase family 1
PfamPF002321.5E-15111174IPR001360Glycoside hydrolase family 1
PRINTSPR001314.0E-10121138IPR001360Glycoside hydrolase family 1
PRINTSPR001314.0E-10145157IPR001360Glycoside hydrolase family 1
PfamPF031014.9E-25291378IPR004330FAR1 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005975Biological Processcarbohydrate metabolic process
GO:0004553Molecular Functionhydrolase activity, hydrolyzing O-glycosyl compounds
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MRHFHGSELP EFSAEEKILL KDSIDFIGIN HYSTFYVQDC LRFSFCSSLS NRTIRGFVQP  60
SPERNGVPIG EHTGMPNFYV VPTGMEGIVE YIKHRYNNKP MMVTENEQVE LTTVGKNGRN  120
GADVRGYMVW SLLDNLEWDK GYTVKFGLYS IEPLTLNRIP KLSARWYARF LGKNDTLGSS  180
YASLDPLDVT LNPVCLFFLS SMDFEIDGDV NGEVVGGSSS YGRVVDDDDD AFVGSSAGGV  240
LQEEIDVKVD DDSSDRELFR LDELQAVNYP ASADEPYVGQ EFESEAAAHA FYNSYATRVG  300
FIIRVSKLSR SRRDGSAIGR ALVCNKEGFR MPDKREKIVR QRAETRVGCR AMILVRKIGS  360
GKWIVTKFVK EHTHPLTPGR GRKDLIYDQY PNEHDKIREL SQQLAIEKKR AATYKRHLEM  420
IIEHIEEHNQ SLGKKMQDIV NSVREMESQE RLGSRY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3gno_A7e-301171290486Os03g0212800 protein
3gnp_A7e-301171290486Os03g0212800 protein
3gnr_A7e-301171290486Os03g0212800 protein
3wba_A7e-301171291487Beta-glucosidase 6
3wbe_A7e-301171291487Beta-glucosidase 6
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098324.11e-151PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A022QCK41e-142A0A022QCK4_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000694951e-124(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA115682325
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.25e-90FAR1 family protein